PHF5A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PHF5A Polyclonal antibody (15554-1-AP)

• Featured Product
• KD/KO Validated

PHF5A Polyclonal Antibody for WB, IP, ELISA

Cat No. 15554-1-AP

Publications(22)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, CoIP, ChIP, ELISA

Synonyms

bK223H9.2, INI, PHD finger protein 5A, PHD finger-like domain protein 5A, PHD finger-like domain-containing protein 5A

• 

  WB analysis using 15554-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15554-1-AP (PHF5A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 15554-1-AP

  WB result of PHF5A antibody (15554-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PHF5A transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 15554-1-AP

  IP result of anti-PHF5A (IP:15554-1-AP, 4ug; Detection:15554-1-AP 1:2000) with HeLa cells lysate 2520 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15554-1-AP targets PHF5A in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7918

  Product name: Recombinant human INI-1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-110 aa of BC007321

  Sequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

• Full Name: PHD finger protein 5A
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-14 kDa
• GenBank Accession Number: BC007321
• Gene Symbol: PHF5A
• Gene ID (NCBI): 84844
• RRID: AB_2165365
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7RTV0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PHD finger-like domain protein 5a (PHF5A) is ubiquitously expressed and is located in the nucleus. The gene Phf5a and its human counterpart PHF5A (former name Ini) are located on rat chromosome 7 (RNO7q34) and human chromosome 22 (HSA2213q2), respectively. The rat gene consists of four exons, while the human gene have five exons. Both genes encode a highly conserved protein of 110 amino acids that contains a PHD finger domain.(PMID: 23675859) It acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha and is involved in pre-mRNA splicing.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Cell Biol; Regulation of transcriptional elongation in pluripotency and cell differentiation by the PHD-finger protein Phf5a.; Authors - Alexandros Strikoudis ; KO Validated
human	WB,IP,IF,ChIP	Gastroenterology; RNA Polymerase II-Associated Factor 1 Regulates Stem Cell Features of Pancreatic Cancer Cells, Independently of the PAF1 Complex, via Interactions With PHF5A and DDX3.; Authors - Saswati Karmakar
human	WB	Gastroenterology; Enterotoxigenic Bacteroides fragilis promotes intestinal inflammation and malignancy by inhibiting exosomes-packaged miR-149-3p.; Authors - Yingying Cao
mouse,human	WB,CoIP,ChIP	Nat Commun; KMT2A associates with PHF5A-PHF14-HMG20A-RAI1 subcomplex in pancreatic cancer stem cells and epigenetically regulates their characteristics; Authors - Mai Abdel Mouti
chicken	WB	Nat Commun; Determination of trunk neural crest cell fate and susceptibility to splicing perturbation by the DLC1-SF3B1-PHF5A splicing complex; Authors - Zhengfan Zheng
		Genes Dev; The cryo-EM structure of the SF3b spliceosome complex bound to a splicing modulator reveals a pre-mRNA substrate competitive mechanism of action.; Authors - Lorenzo I Finci