PHF8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PHF8 Polyclonal antibody (29516-1-AP)

PHF8 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29516-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

DKFZp686E0868, JHDM1F, KDM7B, KIAA1111, MRXSSD, PHD finger protein 8, PHF8, ZNF422

• 

  WB analysis using 29516-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 29516-1-AP (PHF8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 29516-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29516-1-AP (PHF8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 29516-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29516-1-AP (PHF8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, Jurkat cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29516-1-AP targets PHF8 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30701

  Product name: Recombinant human PHF8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 786-948 aa of NM_001184896

  Sequence: GQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGTRVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSN

• Full Name: PHD finger protein 8
• Calculated Molecular Weight: 118 kDa
• Observed Molecular Weight: 125-135 kDa
• GenBank Accession Number: NM_001184896
• Gene Symbol: PHF8
• Gene ID (NCBI): 23133
• RRID: AB_2935473
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPP1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Plant homeodomain finger protein 8 (PHF8) is a JmjC domain-containing protein. PHF8 is localized in the nucleolus and may regulate rRNA transcription. As a member of the KDM7 subfamily of enzymes, PHF8 is involved in demethylation of lysine residues in histones such as H3K27me2/1, H3K9me2/1 and H4K20me1. PHF8 has been reported to participate in cancer development and metastasis of various types of tumors(PMID: 33111613). PHF8 has 5 isoforms produced by alternative splicing(Uniprot).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,IF	iScience; Matrix stiffness aggravates osteoarthritis progression through H3K27me3 demethylation induced by mitochondrial damage; Authors - Tianyou Kan