PHOSPHO2 Polyclonal antibody

• 

  WB analysis using 11869-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11869-1-AP (PHOSPHO2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 11869-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11869-1-AP (PHOSPHO2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 11869-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11869-1-AP (PHOSPHO2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PHOSPHO2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11869-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:3.1.3.74

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11869-1-AP targets PHOSPHO2 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2451

  Product name: Recombinant human PHOSPHO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of BC022324

  Sequence: MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQFLIKD

• Full Name: phosphatase, orphan 2
• Calculated Molecular Weight: 241 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC022324
• Gene Symbol: PHOSPHO2
• Gene ID (NCBI): 493911
• RRID: AB_3085383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCD6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PHOSPHO2 belongs to the HAD-like hydrolase superfamily and PHOSPHO family. PHOSPHO2 is a phosphatase that has high activity toward pyridoxal 5'-phosphate (PLP). PHOSPHO2 is also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate. The molecular weight of PHOSPHO2 is 28 kDa.