PHPT1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86736-3-RR (same clone as 86736-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86736-3-RR (PHPT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86736-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 86736-3-RR (same clone as 86736-3-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using PHPT1 antibody (86736-3-RR, Clone: 251432C1 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86736-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86736-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86736-3-RR against Human PHPT1 were performed. The affinity constant is 2.39 nM.

PHPT1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86736-3-PBS

Clone No.251432C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CGI-202, EC:3.9.1.3, HSPC141, PHP, PHP14

---

Product Information

86736-3-PBS targets PHPT1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3778

  Product name: Recombinant human PHPT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC024648

  Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

• Full Name: phosphohistidine phosphatase 1
• Calculated Molecular Weight: 125 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC024648
• Gene Symbol: PHPT1
• Gene ID (NCBI): 29085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NRX4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.