PHYHD1 Polyclonal antibody

• 

  WB analysis of human liver using 16125-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16125-1-AP (PHYHD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 16125-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16125-1-AP (PHYHD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 16125-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 16125-1-AP (PHYHD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16125-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16125-1-AP (PHYHD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PHYHD1 Polyclonal Antibody for WB, ELISA

Cat No. 16125-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PHYHD1

---

Tested Applications

• Positive WB detected in: human liver tissue, L02 cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16125-1-AP targets PHYHD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9108

  Product name: Recombinant human PHYHD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-297 aa of BC009373

  Sequence: MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKSPLIRTPPSCTRSPWAGCWACGSQWRMPRWRTAVSGSSLAPTPVVCQGGWSGPLLAQRLVPASLGQSQPGITASLCPPQCREGPWSSSMEKWYTRASRTSLTARARPTLSTSWRPLAPPGARRTGSSQQLNCPFPNCTPKGSRRAGALAPPG

• Full Name: phytanoyl-CoA dioxygenase domain containing 1
• Calculated Molecular Weight: 297 aa, 33 kDa
• Observed Molecular Weight: 30-32 kDa
• GenBank Accession Number: BC009373
• Gene Symbol: PHYHD1
• Gene ID (NCBI): 254295
• RRID: AB_2163752
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5SRE7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.