PI3 Kinase p110 Delta Monoclonal antibody, PBS Only

• 

  WB analysis of LNCaP using 67964-1-Ig (same clone as 67964-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67964-1-Ig (PIK3CD antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67964-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67964-1-Ig (same clone as 67964-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67964-1-Ig (PIK3CD antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67964-1-PBS in a different storage buffer formulation.

• 

  IF Staining of LNCaP using 67964-1-Ig (same clone as 67964-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed LNCaP cells using PIK3CD antibody (67964-1-Ig, Clone: 2G11C6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67964-1-PBS in a different storage buffer formulation.

PI3 Kinase p110 Delta Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67964-1-PBS

Clone No.2G11C6

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

p110D, PI3 kinase subunit delta, PI3K delta, PIK3CD, PtdIns 3 kinase subunit delta

---

Product Information

67964-1-PBS targets PI3 Kinase p110 Delta in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26995

  Product name: Recombinant human PIK3CD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 395-580 aa of BC132919

  Sequence: YAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSAL

• Full Name: phosphoinositide-3-kinase, catalytic, delta polypeptide
• Calculated Molecular Weight: 1044 aa, 120 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC132919
• Gene Symbol: PIK3CD
• Gene ID (NCBI): 5293
• RRID: AB_2918715
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00329
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.