PI3 Kinase p110 Delta Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PI3 Kinase p110 Delta Polyclonal antibody (21708-1-AP)

PI3 Kinase p110 Delta Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21708-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PI3K p110(delta), PIK3CD, PI3K delta, PI3 kinase subunit delta, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform

• 

  WB analysis using 21708-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21708-1-AP (PI3 Kinase p110 Delta antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of LNCaP using 21708-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed LNCaP cells using PI3 Kinase p110 Delta antibody (21708-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PI3 Kinase p110 Delta in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells, RAW 264.7 cells
• Positive IF/ICC detected in: LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21708-1-AP targets PI3 Kinase p110 Delta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16326

  Product name: Recombinant human PIK3CD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-381 aa of BC132919

  Sequence: SLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINI

• Full Name: phosphoinositide-3-kinase, catalytic, delta polypeptide
• Calculated Molecular Weight: 1044 aa, 120 kDa
• Observed Molecular Weight: 110-130 kDa
• GenBank Accession Number: BC132919
• Gene Symbol: PIK3CD
• Gene ID (NCBI): 5293
• RRID: AB_3085666
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00329
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PI3 Kinase p110 Delta Polyclonal antibody (Cat# 21708-1-AP) has 7 citations published in Cell Reports in Medicine, Environmental Health, Cell Reports, Journal of Ethnopharmacology, Cellular and Molecular Life Sciences, Bioorganic & Medicinal Chemistry, and Heliyon. Research fields span bone infection immunotherapy, colitis-to-tumorigenesis, CAR-T cell biology, rheumatoid arthritis, macrophage polarization via PI3K/Akt/NF-κB signaling, B-cell lymphoma drug discovery, and atopic dermatitis. Applications cited include WB, IHC, and IF across human, mouse, and rat species.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Rep Med; Metabolically engineered probiotic OMVs as nanovaccine mediating sequential immunomodulation for chronic bone infection immunotherapy.; Authors - Jie Lei
mouse	IHC	Environ Health (Wash); Network Toxicology and In Vivo Studies Reveal the Toxicity and Mechanisms of Tributyl Citrate Carried by Microplastics in Promoting Colitis-to-Tumorigenesis Transformation.; Authors - Haosong Chen
		Cell Rep; Calibration of CAR signaling promotes asymmetric cell division to direct CAR-T cell fate and antitumor potency.; Authors - Xiaolin Shen
rat	IF	J Ethnopharmacol; Uncovering the mechanisms of Zhubi decoction against rheumatoid arthritis through an integrated study of network pharmacology, metabolomics, and intestinal flora; Authors - Jing Liu
mouse	WB,IF	Cell Mol Life Sci; FAM76B regulates PI3K/Akt/NF-κB-mediated M1 macrophage polarization by influencing the stability of PIK3CD mRNA; Authors - Juan Wang
human	WB	Bioorg Med Chem; Discovery of 1H-pyrazolo[3,4-d]pyrimidin-4-ylamine derivatives as potent PI3Kδ/BTK dual-target inhibitors for the treatment of B-cell lymphoma.; Authors - Zunyuan Wang