PI4K2A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PI4K2A Polyclonal antibody (15318-1-AP)

• Featured Product
• KD/KO Validated

PI4K2A Polyclonal Antibody for WB, ELISA

Cat No. 15318-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

PIK42A, PI4KII, PI 4-kinase II alpha, Phosphatidylinositol 4-kinase type II-alpha, Phosphatidylinositol 4-kinase type 2-alpha

• 

  WB analysis using 15318-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15318-1-AP (PI4K2A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 15318-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 15318-1-AP (PI4K2A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15318-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 15318-1-AP (PI4K2A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PI4K2A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, K-562 cells, HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15318-1-AP targets PI4K2A in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7564

  Product name: Recombinant human PI4K2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 131-479 aa of BC003167

  Sequence: YQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW

• Full Name: phosphatidylinositol 4-kinase type 2 alpha
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 48-52 kDa
• GenBank Accession Number: BC003167
• Gene Symbol: PI4K2A
• Gene ID (NCBI): 55361
• RRID: AB_2268225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTU6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PI4K2A polyclonal antibody (Cat# 15318-1-AP) has 7 citations published in high-impact journals including Nature, Nature Biotechnology, Molecular Cell, PNAS, EMBO Journal, and Advanced Science. Research fields span phosphoinositide signaling, lysosomal repair and damage sensing, palmitoylation mapping, prostate cancer targeting, Arf GTPase regulation, and lipid droplet formation during adipogenesis. All cited applications are WB or IF in human samples.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; A phosphoinositide signalling pathway mediates rapid lysosomal repair; Authors - Jay Xiaojun Tan ; KD Validated
human	WB	Nat Biotechnol; A palmitoyl transferase chemical-genetic system to map ZDHHC-specific S-acylation; Authors - Cory A Ocasio
human	WB	Mol Cell; Lysosomal damage sensing and lysophagy initiation by SPG20-ITCH; Authors - Pinki Gahlot ; KD Validated
		Adv Sci (Weinh); Targeting the HSPA8-CMA-ATP6V1A Axis Triggers Lysosomal Hyperacidification and Catastrophic Vacuolation in Prostate Cancer.; Authors - Bingzheng An
human	WB	Proc Natl Acad Sci U S A; Addiction to Golgi-resident PI4P synthesis in chromosome 1q21.3-amplified lung adenocarcinoma cells.; Authors - Lei Shi
human	IF	EMBO J; Defining the proximal interaction networks of Arf GTPases reveals a mechanism for the regulation of PLD1 and PI4KB.; Authors - Zhengming Wu