PI4K2A Polyclonal antibody

• 

  WB analysis using 15318-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15318-1-AP (PI4K2A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 15318-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 15318-1-AP (PI4K2A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15318-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 15318-1-AP (PI4K2A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

PI4K2A Polyclonal Antibody for WB, ELISA

Cat No. 15318-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

PIK42A, PI4KII, PI 4-kinase II alpha, Phosphatidylinositol 4-kinase type II-alpha, Phosphatidylinositol 4-kinase type 2-alpha

---

Tested Applications

• Positive WB detected in: HepG2 cells, K-562 cells, HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IF: See 1 publications below

Product Information

15318-1-AP targets PI4K2A in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7564

  Product name: Recombinant human PI4K2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 131-479 aa of BC003167

  Sequence: YQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW

• Full Name: phosphatidylinositol 4-kinase type 2 alpha
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 48-52 kDa
• GenBank Accession Number: BC003167
• Gene Symbol: PI4K2A
• Gene ID (NCBI): 55361
• RRID: AB_2268225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTU6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; A phosphoinositide signalling pathway mediates rapid lysosomal repair; Authors - Jay Xiaojun Tan ; KD Validated
human	IF	EMBO J; Defining the proximal interaction networks of Arf GTPases reveals a mechanism for the regulation of PLD1 and PI4KB.; Authors - Zhengming Wu
human	WB	Proc Natl Acad Sci U S A; Addiction to Golgi-resident PI4P synthesis in chromosome 1q21.3-amplified lung adenocarcinoma cells.; Authors - Lei Shi
human	WB	Nat Biotechnol; A palmitoyl transferase chemical-genetic system to map ZDHHC-specific S-acylation; Authors - Cory A Ocasio
human	WB	Mol Cell; Lysosomal damage sensing and lysophagy initiation by SPG20-ITCH; Authors - Pinki Gahlot ; KD Validated