PIANP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PIANP Polyclonal antibody (32088-1-AP)

• 

  WB analysis using 32088-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32088-1-AP (C12orf53 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

PIANP Polyclonal Antibody for WB, ELISA

Cat No. 32088-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C12orf53, Paired immunoglobin-like type 2 receptor-associating neural protein, PANP, PILR alpha-associated neural protein, PILR-associating neural protein

---

Tested Applications

• Positive WB detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32088-1-AP targets PIANP in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35273

  Product name: Recombinant human C12orf53 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-178 aa of BC035736

  Sequence: SSSSPRTPPAPARPPCARGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLILGEAPATLRPFLFGGRGEGVDP

• Full Name: chromosome 12 open reading frame 53
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC035736
• Gene Symbol: C12orf53
• Gene ID (NCBI): 196500
• RRID: AB_3742525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IYJ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pianp (also known as Leda-1) is a type I transmembrane protein with preferential expression in the mammalian CNS. Its processing is characterized by proteolytic cleavage by a range of proteases including Adam10, Adam17, MMPs, and the γ-secretase complex. Pianp can interact with Pilrα and the GB1a subunit of the GABAB receptor (GBR) complex. Pianp represents a novel candidate gene involved in autism-like behavior, cerebellar and hippocampal pathology, and GBR signaling (PMID: 31511635).