PIAS1 Polyclonal antibody

• 

  WB analysis using 23395-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23395-1-AP (PIAS1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 23395-1-AP

  IP result of anti-PIAS1 (IP:23395-1-AP, 4ug; Detection:23395-1-AP 1:500) with HepG2 cells lysate 2520 ug.

• 

  IHC staining of mouse testis using 23395-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 23395-1-AP (PIAS1 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 23395-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 23395-1-AP (PIAS1 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PIAS1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 23395-1-AP

Publications(12)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, coIP, ELISA

Synonyms

DDXBP1, DEAD/H box-binding protein 1, E3 SUMO-protein ligase PIAS1, E3 SUMO-protein transferase PIAS1, EC:2.3.2.-

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, L02 cells, J774A.1 cells, RAW 264.7 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 12 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

23395-1-AP targets PIAS1 in WB, IHC, IF, IP, coIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18132

  Product name: Recombinant human PIAS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 475-651 aa of BC121797

  Sequence: PSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD

• Full Name: protein inhibitor of activated STAT, 1
• Calculated Molecular Weight: 651 aa, 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC121797
• Gene Symbol: PIAS1
• Gene ID (NCBI): 8554
• RRID: AB_2879272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75925
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; CryoET reveals organelle phenotypes in huntington disease patient iPSC-derived and mouse primary neurons; Authors - Gong-Her Wu
human	WB	Nat Commun; Crosstalk between SUMOylation and ubiquitylation controls DNA end resection by maintaining MRE11 homeostasis on chromatin; Authors - Tao Zhang
rat,mouse	WB,coIP	J Hazard Mater; Dual effects of JNK activation in blood-milk barrier damage induced by zinc oxide nanoparticles.; Authors - Junrong Wu
human	WB,IF	PLoS Pathog; PIAS1-mediated SUMOylation of influenza A virus PB2 restricts viral replication and virulence.; Authors - Guangwen Wang ; KD Validated
human	WB	Mol Med Rep; Role of SUMOylation of STAT1 in tubular epithelial‑mesenchymal transition induced by high glucose; Authors - Cunyang Gu
human	WB,IHC	DNA Cell Biol; miR-182-5p and miR-96-5p Target PIAS1 and Mediate the Negative Feedback Regulatory Loop between PIAS1 and STAT3 in Endometrial Cancer.; Authors - Yuzhen Xiao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Praveen (Verified Customer) (02-25-2019)

WORK WELL

• Applications: Immunoprecipitation,
• Cell Tissue Type: Ac16

PIAS1 Antibody Immunoprecipitation, validation ( dilution) in Ac16 (Cat no:23395-1-AP)