PIAS1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82873-2-RR (same clone as 82873-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82873-2-RR (PIAS1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82873-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 82873-2-RR (same clone as 82873-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 82873-2-RR (PIAS1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82873-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 82873-2-RR (same clone as 82873-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 82873-2-RR (PIAS1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82873-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82873-2-RR (same clone as 82873-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PIAS1 antibody (82873-2-RR, Clone: 1C22 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82873-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 82873-2-RR (same clone as 82873-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug PIAS1 Recombinant antibody (82873-2-RR, Clone:1C22) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 82873-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82873-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82873-2-RR against Human PIAS1 were performed. The affinity constant is 5.01 nM.

PIAS1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 82873-2-PBS

Clone No.1C22

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

EC:2.3.2.-, E3 SUMO-protein transferase PIAS1, E3 SUMO-protein ligase PIAS1, DEAD/H box-binding protein 1, DDXBP1

---

Product Information

82873-2-PBS targets PIAS1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18132

  Product name: Recombinant human PIAS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 475-651 aa of BC121797

  Sequence: PSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD

• Full Name: protein inhibitor of activated STAT, 1
• Calculated Molecular Weight: 651 aa, 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC121797
• Gene Symbol: PIAS1
• Gene ID (NCBI): 8554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75925
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.