PIAS2 Recombinant monoclonal antibody, PBS Only (Capture)

PIAS2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84189-4-PBS
Clone No.241474G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

241474G8, Androgen receptor-interacting protein 3, ARIP3, DAB2-interacting protein, DIP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84189-4-PBS targets PIAS2 as part of a matched antibody pair:

MP01062-1: 84189-4-PBS capture and 84189-1-PBS detection (validated in Cytometric bead array)

MP01062-2: 84189-4-PBS capture and 84189-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9032

Product name: Recombinant human PIAS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-346 aa of BC015190

Sequence: MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMC

Predict reactive species
Full Name protein inhibitor of activated STAT, 2
Calculated Molecular Weight 63 kDa, 69 kDa
Observed Molecular Weight63-68 kDa
GenBank Accession NumberBC015190
Gene Symbol PIAS2
Gene ID (NCBI) 9063
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75928
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PIAS2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. PIAS2 also plays a crucial role as a transcriptional coregulator in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. PIAS2 has 3 isoforms produced by alternative splicing with the MW of 68 kDa, 63 kDa and 45 kDa.

Loading...
||
New chat Able
正在加载,请稍候...