PIGK Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84568-3-RR (same clone as 84568-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84568-3-RR (PIGK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84568-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84568-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84568-3-RR against Human PIGK were performed. The affinity constant is 0.501 nM.

PIGK Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84568-3-PBS

Clone No.241989D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

hGPI8, GPI-anchor transamidase, GPI8, GPI transamidase, EC:3.-.-.-

---

Product Information

84568-3-PBS targets PIGK in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3497

  Product name: Recombinant human PIGK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC026186

  Sequence: MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGGIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESRYSS

• Full Name: phosphatidylinositol glycan anchor biosynthesis, class K
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC026186
• Gene Symbol: PIGK
• Gene ID (NCBI): 10026
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q92643
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phosphatidylinositol glycan, class K (PIGK), is a crucial member of the glycosyl-phosphatidylinositol transamidase (GPIT) protein complex that attaches a diverse group of macromolecules to the plasma membrane of eukaryotes. The human PIGK gene is involved in the key step of transferring GPI-anchor to the respective protein molecules in the plasma membrane (PMID: 22824918). Endogenous PIGK has 2 isoforms, 45 kDa and 36 kDa (PMID: 34193731).