PIGM Polyclonal antibody

• 

  WB analysis of HeLa using 20421-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20421-1-AP (PIGM antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 20421-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20421-1-AP (PIGM antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 20421-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20421-1-AP (PIGM antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 20421-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20421-1-AP (PIGM antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 20421-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20421-1-AP (PIGM antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HeLa using 20421-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 20421-1-AP (PIGM antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

PIGM Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20421-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PIG-M, PIG M, Phosphatidylinositol-glycan biosynthesis class M protein, GPI-MT-I, GPI mannosyltransferase 1

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human testis tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20421-1-AP targets PIGM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14245

  Product name: Recombinant human PIGM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 231-299 aa of BC019865

  Sequence: VAVAGLTFFALSFGFYYEYGWEFLEHTYFYHLTRRDIRHNFSPYFYMLYLTAESKWSFSLGIAAFLPQL

• Full Name: phosphatidylinositol glycan anchor biosynthesis, class M
• Calculated Molecular Weight: 423 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC019865
• Gene Symbol: PIGM
• Gene ID (NCBI): 93183
• RRID: AB_10734320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3S5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.