PIGO Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PIGO Polyclonal antibody, PBS Only (16369-1-PBS)

• 

  WB analysis of HeLa using 16369-1-AP (same clone as 16369-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16369-1-AP (PIGO antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16369-1-AP (same clone as 16369-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16369-1-AP (PIGO antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 16369-1-AP (same clone as 16369-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 16369-1-AP (PIGO antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 16369-1-AP (same clone as 16369-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 16369-1-AP (PIGO antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16369-1-AP (PIGO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16369-1-AP (PIGO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16369-1-AP (PIGO antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 16369-1-AP (same clone as 16369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 16369-1-AP (PIGO antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 16369-1-AP (same clone as 16369-1-PBS)

  Immunofluorescent analysis of MCF-7 cells, using PIGO antibody 16369-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 16369-1-PBS in a different storage buffer formulation.

PIGO Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16369-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EC:2.-.-.-, Phosphatidylinositol-glycan biosynthesis class O protein, PIG O, PIG-O, RP11 182N22.4

---

Product Information

16369-1-PBS targets PIGO in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9232

  Product name: Recombinant human PIGO protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 867-1089 aa of BC013987

  Sequence: FLLLHLLAAGIPVTTPGPFTVPWQAVSAWALMATQTFYSTGHQPVFPAIHWHAAFVGFPEGHGSCTWLPALLVGANTFASHLLFAVGCPLLLLWPFLCESQGLRKRQQPPGNEADARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFILGIQILACALAASILRRHLMVWKVFAPKFIFEAVGFIVSSVGLLLGIALVMRVDGAVSSWFRQLFLAQQR

• Full Name: phosphatidylinositol glycan anchor biosynthesis, class O
• Calculated Molecular Weight: 1089aa,119 kDa; 454aa,50 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC013987
• Gene Symbol: PIGO
• Gene ID (NCBI): 84720
• RRID: AB_2164806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TEQ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PIGO (Phosphatidylinositol-glycan biosynthesis class O protein) is an enzyme crucial for attaching GPI anchors to proteins in the endoplasmic reticulum. PIGO encodes a 1,089 amino acid protein, that is involved in GPI biosynthesis (PMID: 22683086).