PIGR Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PIGR Polyclonal antibody, PBS Only (22024-1-PBS)

• 

  IHC staining of human colon cancer using 22024-1-AP (same clone as 22024-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 22024-1-AP (PIGR antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 22024-1-AP (same clone as 22024-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Colorectal cancer slide using 22024-1-AP (PIGR antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 22024-1-AP (same clone as 22024-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 22024-1-AP (PIGR antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 22024-1-AP (same clone as 22024-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 22024-1-AP (PIGR antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 22024-1-AP (same clone as 22024-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 22024-1-AP (PIGR Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 22024-1-AP (same clone as 22024-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 22024-1-AP (PIGR Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 22024-1-AP (same clone as 22024-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22024-1-AP (PIGR Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 22024-1-AP (same clone as 22024-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22024-1-AP (PIGR Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human small intestine using 22024-1-AP (same clone as 22024-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human small intestine tissue using PIGR antibody (22024-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse small intestine using 22024-1-AP (same clone as 22024-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse small intestine tissue using PIGR antibody (22024-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse small intestine using 22024-1-AP (same clone as 22024-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse small intestine tissue using PIGR antibody (22024-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22024-1-PBS in a different storage buffer formulation.

PIGR Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 22024-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Secretory component, Poly-Ig receptor, Poly Ig receptor, Hepatocellular carcinoma-associated protein TB6

---

Product Information

22024-1-PBS targets PIGR in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16876

  Product name: Recombinant human PIGR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 289-638 aa of BC110494

  Sequence: RAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQADGSRASVDSGSSEEQGGSSR

• Full Name: polymeric immunoglobulin receptor
• Calculated Molecular Weight: 764 aa, 83 kDa
• GenBank Accession Number: BC110494
• Gene Symbol: PIGR
• Gene ID (NCBI): 5284
• RRID: AB_2878974
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01833
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.