PIGS Polyclonal antibody

• 

  WB analysis of HeLa using 18334-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 18334-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  WB analysis of PC-3 using 18334-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18334-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 18334-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 18334-1-AP (PIGS Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 18334-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PIGS antibody (18334-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

PIGS Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 18334-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

UNQ1873/PRO4316, Phosphatidylinositol-glycan biosynthesis class S protein, GPI transamidase component PIG-S

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, HepG2 cells, mouse liver tissue, PC-3 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

18334-1-AP targets PIGS in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12950

  Product name: Recombinant human PIGS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 313-555 aa of BC001319

  Sequence: SSAASLYPVLNFLLYVPELAHSPLYIQDKDGAPVATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEVDMVRVMEVFLAQLRLLFGIAQPQLPPKCLLSGPTSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLVKIFLETRKSWRKPEKTD

• Full Name: phosphatidylinositol glycan anchor biosynthesis, class S
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC001319
• Gene Symbol: PIGS
• Gene ID (NCBI): 94005
• RRID: AB_2878532
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96S52
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIGS, also named as GPI transamidase component PIG-S or PRO4316, is a 555 amino acid protein, which belongs to the PIGS family. PIGS localizes in the endoplasmic reticulum membrane. PIGS is a component of the GPI transamidase complex. It is essential for transfer of GPI to proteins, particularly for formation of carbonyl intermediates.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; Identification of mammalian glycoproteins with type-I LacdiNAc structures synthesized by the glycosyltransferase B3GALNT2.; Authors - Takahiro Nakane
human,mouse	WB	Nat Commun; Proteomic screens of SEL1L-HRD1 ER-associated degradation substrates reveal its role in glycosylphosphatidylinositol-anchored protein biogenesis; Authors - Xiaoqiong Wei