PIGX Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PIGX Polyclonal antibody, PBS Only (17120-1-PBS)

• 

  WB analysis using 17120-1-AP (same clone as 17120-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17120-1-AP (PIGX antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17120-1-PBS in a different storage buffer formulation.

PIGX Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17120-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17120-1-PBS targets PIGX in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10808

  Product name: Recombinant human PIGX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC022542

  Sequence: MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALDNEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL

• Full Name: phosphatidylinositol glycan anchor biosynthesis, class X
• Calculated Molecular Weight: 217aa,25 kDa; 258aa,29 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC022542
• Gene Symbol: PIGX
• Gene ID (NCBI): 54965
• RRID: AB_3669260
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TBF5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PIGX encodes a 258-amino acid ER-resident type I transmembrane protein with a large lumenal domain. It acts by stabilizing the mannosyltransferase PIGM. PIGX might function as a cyclic dimeric GMP phosphodiesterase.