PIK3C2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PIK3C2B Polyclonal antibody, PBS Only (24788-1-PBS)

• 

  WB analysis using 24788-1-AP (same clone as 24788-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24788-1-AP (PIK3C2B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24788-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 24788-1-AP (same clone as 24788-1-PBS)

  IP result of anti-PIK3C2B (IP:24788-1-AP, 4ug; Detection:24788-1-AP 1:1500) with HeLa cells lysate 1240 ug. This data was developed using the same antibody clone with 24788-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 24788-1-AP (same clone as 24788-1-PBS)

  IP result of anti-PIK3C2B (IP:24788-1-AP, 5ug; Detection:24788-1-AP 1:800) with HeLa cells lysate 2500ug. This data was developed using the same antibody clone with 24788-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 24788-1-AP (same clone as 24788-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24788-1-AP (PIK3C2B Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24788-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 24788-1-AP (same clone as 24788-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24788-1-AP (PIK3C2B Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24788-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 24788-1-AP (same clone as 24788-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 24788-1-AP (PIK3C2B antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24788-1-PBS in a different storage buffer formulation.

PIK3C2B Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 24788-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

24788-1-PBS targets PIK3C2B in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20474

  Product name: Recombinant human PIK3C2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC132876

  Sequence: MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPKGSLSGDYLYIFDGSDGGVSSSPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSSSKISQPSDINTFSLVEQLPGKLLEHRILEEEEVLGGGGQGRLLGSVDYDGINDAITRLNLKSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTMPPQVPPRTYASRYGNRKNATPGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGS

• Full Name: phosphoinositide-3-kinase, class 2, beta polypeptide
• Calculated Molecular Weight: 1634 aa, 185 kDa
• Observed Molecular Weight: 160-185 kDa
• GenBank Accession Number: BC132876
• Gene Symbol: PIK3C2B
• Gene ID (NCBI): 5287
• RRID: AB_2879725
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00750
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.