PIM3 Polyclonal antibody

PIM3 Polyclonal Antibody for WB, ELISA

Cat No. 33202-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

pim 3, pim 3 oncogene

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWB

WB analysis using 33202-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 33202-1-AP (PIM3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in

mouse kidney tissue

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

33202-1-AP targets PIM3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag39664 Product name: Recombinant human PIM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 242-326 aa of BC141855 Sequence: DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL Predict reactive species
Full Name	pim-3 oncogene
Calculated Molecular Weight	326 aa, 36 kDa
Observed Molecular Weight	40 kDa
GenBank Accession Number	BC141855
Gene Symbol	PIM3
Gene ID (NCBI)	415116
RRID	AB_3742893
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	Q86V86
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
WB protocol for PIM3 antibody 33202-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
human,mouse	WB	Invest Ophthalmol Vis Sci PIM1 Inhibition Alleviates Aspergillus fumigatus Keratitis by Regulating DDX41-Mediated STING Signaling Pathway. Authors - Fang Han View Article
human	IHC	World J Surg Oncol Role and mechanism of PIM family in the immune microenvironment of diffuse large B cell lymphoma Authors - Changying Wang View Article