PIM3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PIM3 Polyclonal antibody (33202-1-AP)

• 

  WB analysis using 33202-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33202-1-AP (PIM3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PIM3 Polyclonal Antibody for WB, ELISA

Cat No. 33202-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

pim 3, pim 3 oncogene

---

Tested Applications

• Positive WB detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

33202-1-AP targets PIM3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39664

  Product name: Recombinant human PIM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-326 aa of BC141855

  Sequence: DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL

• Full Name: pim-3 oncogene
• Calculated Molecular Weight: 326 aa, 36 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC141855
• Gene Symbol: PIM3
• Gene ID (NCBI): 415116
• RRID: AB_3742893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86V86
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Invest Ophthalmol Vis Sci; PIM1 Inhibition Alleviates Aspergillus fumigatus Keratitis by Regulating DDX41-Mediated STING Signaling Pathway.; Authors - Fang Han
human	IHC	World J Surg Oncol; Role and mechanism of PIM family in the immune microenvironment of diffuse large B cell lymphoma; Authors - Changying Wang