PIN4 Polyclonal antibody

• 

  WB analysis of mouse liver using 15789-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15789-1-AP (PIN4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15789-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15789-1-AP (PIN4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 15789-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15789-1-AP (PIN4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 15789-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15789-1-AP (PIN4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15789-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15789-1-AP (PIN4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15789-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15789-1-AP (PIN4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 15789-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15789-1-AP (PIN4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15789-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15789-1-AP (PIN4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 15789-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15789-1-AP (PIN4 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 15789-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15789-1-AP (PIN4 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 15789-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15789-1-AP (PIN4 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 15789-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15789-1-AP (PIN4 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 15789-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PIN4 antibody (15789-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

PIN4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15789-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Peptidyl-prolyl cis/trans isomerase EPVH, Parvulin-17, Parvulin-14, hPar14, EPVH

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HeLa cells, mouse brain tissue, mouse kidney tissue
• Positive IHC detected in: human liver cancer tissue, human kidney tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

15789-1-AP targets PIN4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8489

  Product name: Recombinant human PIN4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 10-140 aa of BC005234

  Sequence: MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

• Full Name: protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
• Calculated Molecular Weight: 131 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC005234
• Gene Symbol: PIN4
• Gene ID (NCBI): 5303
• RRID: AB_2878186
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y237
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIN4, also known as EPVH, hPar14, is a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. PIN4 is the first eukaryotic member of the parvulin family of PPIases and contains a PPIase domain preceded by a 40-amino acid glycine- and lysine-rich N-terminal sequence.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Med; Par14 interacts with the androgen receptor, augmenting both its transcriptional activity and prostate cancer proliferation; Authors - Miki Naito ; KD Validated