PIP5K1C Polyclonal antibody

• 

  WB analysis of A549 using 27640-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 27640-1-AP (PIP5K1C antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 27640-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27640-1-AP (PIP5K1C antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 27640-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27640-1-AP (PIP5K1C antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PIP5K1C Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27640-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, ELISA

Synonyms

KIAA0589, LCCS3, PIP5K GAMMA, PIP5K1 gamma, PIP5K1C, PIP5Kgamma, PIP5KIgamma, PtdIns(4)P 5 kinase 1 gamma

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

27640-1-AP targets PIP5K1C in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26525

  Product name: Recombinant human PIP5K1C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 480-573 aa of NM_001195733

  Sequence: MIPSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQ

• Full Name: phosphatidylinositol-4-phosphate 5-kinase, type I, gamma
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001195733
• Gene Symbol: PIP5K1C
• Gene ID (NCBI): 23396
• RRID: AB_2880936
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60331
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	J Immunol Res; PIPKIγ Regulates CCL2 Expression in Colorectal Cancer by Activating AKT-STAT3 Signaling.; Authors - JunLi Xue
human	IHC	EBioMedicine; Type Iγ phosphatidylinositol phosphate kinase promotes tumor growth by facilitating Warburg effect in colorectal cancer.; Authors - Wei Peng