PIR Monoclonal antibody

• 

  WB analysis of HSC-T6 using 67516-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67516-1-Ig (PIR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 67516-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67516-1-Ig (PIR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67516-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67516-1-Ig (PIR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 67516-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67516-1-Ig (PIR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

PIR Monoclonal Antibody for WB, ELISA

Cat No. 67516-1-Ig

Clone No.2A10E4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

PIR, Pirin

---

Tested Applications

• Positive WB detected in: HSC-T6 cells, HeLa cells, K-562 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67516-1-Ig targets PIR in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29969

  Product name: Recombinant human PIR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 46-230 aa of BC002517

  Sequence: KGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVEN

• Full Name: pirin (iron-binding nuclear protein)
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC002517
• Gene Symbol: PIR
• Gene ID (NCBI): 8544
• RRID: AB_2882737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00625
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pirin (iron-binding nuclear protein, PIR) is a highly conserved 32-kDa protein consisting of 290 amino acids. Pirin mRNA is expressed weakly in all human tissues. Confocal immunofluorescence experiments demonstrate a predominant localization of Pirin within dot-like subnuclear structures. Pirin interacts with the oncoprotein B-cell lymphoma 3-encoded (Bcl-3) and nuclear factor I (NFI).