PKC Alpha Recombinant monoclonal antibody, PBS Only

PKC Alpha Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83840-5-PBS
Clone No.240926F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

PRKCA, 240926F6, AAG6, EC:2.7.11.13, PKC A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83840-5-PBS targets PKC Alpha in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1025

Product name: Recombinant human PRKCA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-216 aa of BC109274

Sequence: MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIR

Predict reactive species
Full Name protein kinase C, alpha
Observed Molecular Weight 77 kDa
GenBank Accession NumberBC109274
Gene Symbol PKC Alpha
Gene ID (NCBI) 5578
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP17252
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. PRKCA is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.

Loading...
||
New chat Able
正在加载,请稍候...