Tested Applications
| Positive IF/ICC detected in | K-562 cells |
| Positive FC (Intra) detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-12919 targets PKC Beta in IF/ICC, FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3591 Product name: Recombinant human PRKCB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 342-598 aa of BC036472 Sequence: FNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHA Predict reactive species |
| Full Name | protein kinase C, beta |
| Calculated Molecular Weight | 673 aa, 77 kDa |
| GenBank Accession Number | BC036472 |
| Gene Symbol | PRKCB |
| Gene ID (NCBI) | 5579 |
| RRID | AB_2919063 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05771 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. Protein kinase Cs (PKCs) are signaling molecules that play key roles in many cellular processes, including secretion, gene expression, proliferation, and muscle contraction. The PKC family is broadly divided into three subgroups: classical, novel, and atypical PKCs. These subgroups differ in both protein sequences and mechanistic requirements for catalytic activity. PKC beta is one of the PKC family members. PKC beta has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. This antibody can recognize PKC beta, PKC alpha, PKC gamma, PKC epsilon and PKC delta.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 PKC Beta antibody CL488-12919 | Download protocol |
| IF protocol for CL Plus 488 PKC Beta antibody CL488-12919 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



