PKC Gamma Monoclonal antibody, PBS Only

• 

  WB analysis using 66429-1-Ig (same clone as 66429-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66429-1-Ig (PKC gamma antibody at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66429-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 66429-1-Ig (same clone as 66429-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 66429-1-Ig (PKC gamma antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66429-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 66429-1-Ig (same clone as 66429-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 66429-1-Ig (PKC gamma antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66429-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 66429-1-Ig (same clone as 66429-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed SH-SY5Y cells using 66429-1-Ig(PKC gamma antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66429-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 66429-1-Ig (same clone as 66429-1-PBS)

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.2 ug Anti-Human PKC Gamma (66429-1-Ig, Clone:2F4B9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66429-1-PBS in a different storage buffer formulation.

PKC Gamma Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 66429-1-PBS

Clone No.2F4B9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

PRKCG, 2F4B9, EC:2.7.11.13, PKCC, PKCG

---

Product Information

66429-1-PBS targets PKC Gamma in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5910

  Product name: Recombinant human PRKCG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 351-697 aa of BC047876

  Sequence: FSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM

• Full Name: protein kinase C, gamma
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC047876
• Gene Symbol: PKC Gamma
• Gene ID (NCBI): 5582
• RRID: AB_2881800
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05129
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC gamma is a neuron-specific member of the classical PKCs and is activated and translocated to subcellular regions as a result of various stimuli, including diacylglycerol synthesis, increased intracellular Ca(2+) and phorbol esters. Defects in this protein have been associated with spinocerebellar ataxia type 14 (SCA14), an autosomal dominant neurodegenerative disease.