PKD2L1 Polyclonal antibody

• 

  WB analysis of human liver using 13117-2-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13117-2-AP (PKD2L1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13117-2-AP

  WB result of PKD2L1 antibody (13117-2-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-PKD2L1 transfected HepG2 cells.

• Featured Product
• KD/KO Validated

PKD2L1 Polyclonal Antibody for WB, ELISA

Cat No. 13117-2-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

PCL, PKD2L, PKD2L1, PKDL, Polycystin 2 homolog, Polycystin 2L1, Polycystin L, Polycystin L1, TRPP3

---

Tested Applications

• Positive WB detected in: human liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 2 publications below

Product Information

13117-2-AP targets PKD2L1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3807

  Product name: Recombinant human PKD2L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 561-805 aa of BC025665

  Sequence: NDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVSSPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGWLAPSPGVKEQAIWKHPQPAPAVTPDPWGVQGGQESEVPYKREEEALEERRLSRGEIPTLQRS

• Full Name: polycystic kidney disease 2-like 1
• Calculated Molecular Weight: 805 aa, 92 kDa
• Observed Molecular Weight: 75-85 kDa, 92 kDa
• GenBank Accession Number: BC025665
• Gene Symbol: PKD2L1
• Gene ID (NCBI): 9033
• RRID: AB_2163481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0L9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	iScience; Graded spikes differentially signal neurotransmitter input in cerebrospinal fluid contacting neurons of the mouse spinal cord; Authors - Emily Johnson
mouse	WB,IF	Front Cell Neurosci; The neural stem cell properties of Pkd2l1+ cerebrospinal fluid-contacting neurons in vivo; Authors - Liang Cao