Tested Applications
| Positive IHC detected in | mouse embryo tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11743-1-AP targets PKIA in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2338 Product name: Recombinant human PKIA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC022265 Sequence: MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES Predict reactive species |
| Full Name | protein kinase (cAMP-dependent, catalytic) inhibitor alpha |
| Calculated Molecular Weight | 76 aa, 8 kDa |
| GenBank Accession Number | BC022265 |
| Gene Symbol | PKIA |
| Gene ID (NCBI) | 5569 |
| RRID | AB_3085380 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61925 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
cAMP-dependent protein kinase inhibitor alpha (PKIA) is also named as PRKACN1, and belongs to the PKI family. Among them, PKIA, a member of protein kinase A (PKA) inhibitor family, was found to be most significantly and highly expressed in susceptible animals (PMID:24910983). Decreased PKIA signaling would directly impact PKA activation, potentially inducing DRP1 phosphorylation and increasing ER Ca2+ stores (PMID:32152556). miR-129-5p activated PKA to regulate the phosphorylation of beta-catenin and cAMP-response element binding protein (CREB) by inhibiting PKIA (PMID:36222334).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PKIA antibody 11743-1-AP | Download protocol |
| IHC protocol for PKIA antibody 11743-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









