Tested Applications
| Positive WB detected in | mouse heart tissue |
| Positive IF/ICC detected in | Hela cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21371-1-AP targets PKIG in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15878 Product name: Recombinant human PKIG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC104257 Sequence: MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS Predict reactive species |
| Full Name | protein kinase (cAMP-dependent, catalytic) inhibitor gamma |
| Calculated Molecular Weight | 76 aa, 8 kDa |
| Observed Molecular Weight | 5-8 kDa |
| GenBank Accession Number | BC104257 |
| Gene Symbol | PKIG |
| Gene ID (NCBI) | 11142 |
| RRID | AB_10858922 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y2B9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PKIG antibody 21371-1-AP | Download protocol |
| WB protocol for PKIG antibody 21371-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





