PKIG Polyclonal antibody

• 

  WB analysis of mouse heart using 21371-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 21371-1-AP (PKIG antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 21371-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 21371-1-AP (PKIG antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 21371-1-AP

  Immunofluorescent analysis of Hela cells, using PKIG antibody 21371-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

PKIG Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21371-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

PKI gamma, PKIG

---

Tested Applications

• Positive WB detected in: mouse heart tissue
• Positive IF/ICC detected in: Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

21371-1-AP targets PKIG in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15878

  Product name: Recombinant human PKIG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of BC104257

  Sequence: MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS

• Full Name: protein kinase (cAMP-dependent, catalytic) inhibitor gamma
• Calculated Molecular Weight: 76 aa, 8 kDa
• Observed Molecular Weight: 5-8 kDa
• GenBank Accession Number: BC104257
• Gene Symbol: PKIG
• Gene ID (NCBI): 11142
• RRID: AB_10858922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2B9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Biol Chem; cAMP-Dependent Protein Kinase (PKA) Signaling is Impaired in the Diabetic Heart.; Authors - Lee B Bockus