Plakophilin 1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Plakophilin 1 Polyclonal antibody, PBS Only (22632-1-PBS)

• 

  WB analysis using 22632-1-AP (same clone as 22632-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22632-1-AP (PKP1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22632-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 22632-1-AP (same clone as 22632-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22632-1-AP (Plakophilin 1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22632-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 22632-1-AP (same clone as 22632-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 22632-1-AP (PKP1 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22632-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 22632-1-AP (same clone as 22632-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using PKP1 antibody (22632-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 22632-1-PBS in a different storage buffer formulation.

Plakophilin 1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 22632-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PKP1, B6P, Plakophilin-1

---

Product Information

22632-1-PBS targets Plakophilin 1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18153

  Product name: Recombinant human PKP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 412-726 aa of BC114571

  Sequence: NLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSRHPLLHRVMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF

• Full Name: plakophilin 1 (ectodermal dysplasia/skin fragility syndrome)
• Calculated Molecular Weight: 747 aa, 83 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC114571
• Gene Symbol: PKP1
• Gene ID (NCBI): 5317
• RRID: AB_3085701
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13835
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Plakophilin 1, also known as PKP1, B6P, is a member of the arm-repeat protein family. PKP1 contains arm-repeat (armadillo) domains, localizes to nuclei and cell desmosomes, and participates in linking cadherins to intermediate filaments in the cytoskeleton (PMID: 10747098). PKP1 contributes to epidermal morphogenesis and facilitates the formation of intermediate filaments. Mutations in PKP1 have been associated with the ectodermal dysplasia/skin fragility syndrome (PubMed:9326952, 10852826).