Plakophilin 3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Plakophilin 3 Polyclonal antibody (18338-1-AP)

Plakophilin 3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18338-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

PKP3, Plakophilin-3

• 

  WB analysis of K-562 using 18338-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 18338-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 18338-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 18338-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A549 using 18338-1-AP

  IP result of anti-Plakophilin 3 (IP:18338-1-AP, 4ug; Detection:18338-1-AP 1:600) with A549 cells lysate 1000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 18338-1-AP (Plakophilin 3 antibody at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 18338-1-AP (Plakophilin 3 antibody at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat cerebellum using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat skin using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 18338-1-AP (Plakophilin 3 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 18338-1-AP (Plakophilin 3 antibody at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 18338-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 18338-1-AP (Plakophilin 3 antibody at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Plakophilin 3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, A549 cells, HeLa cells, MCF-7 cells
• Positive IP detected in: A549 cells
• Positive IHC detected in: human skin tissue, human placenta tissue, human colon tissue, human stomach cancer tissue, human bowen disease tissue, mouse skin tissue, rat cerebellum tissue, rat skin tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18338-1-AP targets Plakophilin 3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13062

  Product name: Recombinant human PKP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 170-400 aa of BC000081

  Sequence: VGSRADYDTLSLRSLRLGPGGLDDRYSLVSEQLEPAATSTYRAFAYERQASSSSSRAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGFNSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSDAAAKKQARSLQAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALV

• Full Name: plakophilin 3
• Calculated Molecular Weight: 87 kDa
• Observed Molecular Weight: 87 kDa
• GenBank Accession Number: BC000081
• Gene Symbol: Plakophilin 3
• Gene ID (NCBI): 11187
• RRID: AB_2164281
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y446
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-PKP3 (Plakophilin 3) antibody, catalog number 18338-1-AP, has a total of 5 citations. These appear in Cell Reports, Journal of Ovarian Research, Scientific Reports, Medical Oncology, and Biomedicines. Research fields include pancreatic cancer initiation and progression, polycystic ovary syndrome, ovarian steroidogenic function, early gastric cancer, and PKP3 overexpression in pancreatic cancer prognosis. Applications span WB and IHC across mouse, human, and rat species.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC	Cell Rep; Plakophilin 3 drives acinar cell transformation and promotes cancer initiation and progression in pancreas.; Authors - Xiaojia Li ; KO Validated
rat	WB,IHC	J Ovarian Res; Cangfu Daotan Wan alleviates polycystic ovary syndrome with phlegm-dampness syndrome via disruption of the PKP3/ERCC1/MAPK axis; Authors - Yuan Li
human	WB	Sci Rep; SHP2 improves ovarian morphology and steroidogenic function in a rat PCOS model by modulating IRE1α/XBP1/NLRP3-mediated granulosa cell pyroptosis.; Authors - DongXue Wang
human	IHC	Med Oncol; Data-independent acquisition (DIA) mass spectrometry reveals related proteins involved in the occurrence of early intestinal-type gastric cancer; Authors - Liangshun Zhang
human	IHC	Biomedicines; Comprehensive Analysis Identifies PKP3 Overexpression in Pancreatic Cancer Related to Unfavorable Prognosis; Authors - Yan Du