PLAC9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLAC9 Polyclonal antibody, PBS Only (17910-1-PBS)

• 

  WB analysis of human testis using 17910-1-AP (same clone as 17910-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 17910-1-AP (PLAC9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17910-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 17910-1-AP (same clone as 17910-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PLAC9 antibody (17910-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17910-1-PBS in a different storage buffer formulation.

PLAC9 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 17910-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

---

Product Information

17910-1-PBS targets PLAC9 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12308

  Product name: Recombinant human PLAC9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-97 aa of BC090922

  Sequence: MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF

• Full Name: placenta-specific 9
• Calculated Molecular Weight: 97 aa, 10 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC090922
• Gene Symbol: PLAC9
• Gene ID (NCBI): 219348
• RRID: AB_2935443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JTB6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.