PLB1 Polyclonal antibody

• 

  WB analysis of DU 145 using 26835-1-AP

  DU 145 cells were subjected to SDS PAGE followed by western blot with 26835-1-AP (PLB1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate hyperplasia using 26835-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 26835-1-AP (PLB1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human prostate hyperplasia using 26835-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 26835-1-AP (PLB1 Antibody) at dilution of 1:200 (under 40x lens).

PLB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26835-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Phospholipase A2, Lysophospholipase, hPLB, EC:3.1.1.5, EC:3.1.1.4

---

Tested Applications

• Positive WB detected in: DU 145 cells
• Positive IHC detected in: human prostate hyperplasia tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26835-1-AP targets PLB1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25240

  Product name: Recombinant human PLB1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 22-372 aa of BC150633

  Sequence: QIHTSPRKSTLEGQLWPETLKNSPFPCNPNKLGVNMPSKSVHSLKPSDIKFVAAIGNLEIPPDPGTGDLEKQDWTERPQQVCMGVMTVLSDIIRYFSPSVPMPVCHTGKRVIPHDGAEDLWIQAQELVRNMKENLQLDFQFDWKLINVFFSNASQCYLCPSAQQNGLAAGGVDELMGVLDYLQQEVPRAFVNLVDLSEVAEVSRQYHGTWLSPAPEPCNCSEETTRLAKVVMQWSYQEAWNSLLASSRYSEQESFTVVFQPFFYETTPSLHSEDPRLQDSTTLAWHLWNRMMEPAGEKDEPLSVKHGRPMKCPSQESPYLFSYRNSNYLTRLQKPQDKLEVREGAEIRCPD

• Full Name: phospholipase B1
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC150633
• Gene Symbol: PLB1
• Gene ID (NCBI): 151056
• RRID: AB_2880652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P1J6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.