PLB1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLB1 Polyclonal antibody, PBS Only (26835-1-PBS)

• 

  WB analysis of DU 145 using 26835-1-AP (same clone as 26835-1-PBS)

  DU 145 cells were subjected to SDS PAGE followed by western blot with 26835-1-AP (PLB1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26835-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate hyperplasia using 26835-1-AP (same clone as 26835-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 26835-1-AP (PLB1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26835-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate hyperplasia using 26835-1-AP (same clone as 26835-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 26835-1-AP (PLB1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26835-1-PBS in a different storage buffer formulation.

PLB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26835-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Phospholipase A2, Lysophospholipase, hPLB, EC:3.1.1.5, EC:3.1.1.4

---

Product Information

26835-1-PBS targets PLB1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25240

  Product name: Recombinant human PLB1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 22-372 aa of BC150633

  Sequence: QIHTSPRKSTLEGQLWPETLKNSPFPCNPNKLGVNMPSKSVHSLKPSDIKFVAAIGNLEIPPDPGTGDLEKQDWTERPQQVCMGVMTVLSDIIRYFSPSVPMPVCHTGKRVIPHDGAEDLWIQAQELVRNMKENLQLDFQFDWKLINVFFSNASQCYLCPSAQQNGLAAGGVDELMGVLDYLQQEVPRAFVNLVDLSEVAEVSRQYHGTWLSPAPEPCNCSEETTRLAKVVMQWSYQEAWNSLLASSRYSEQESFTVVFQPFFYETTPSLHSEDPRLQDSTTLAWHLWNRMMEPAGEKDEPLSVKHGRPMKCPSQESPYLFSYRNSNYLTRLQKPQDKLEVREGAEIRCPD

• Full Name: phospholipase B1
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC150633
• Gene Symbol: PLB1
• Gene ID (NCBI): 151056
• RRID: AB_2880652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P1J6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.