PLCD1 Monoclonal antibody, PBS Only

• 

  WB analysis of human testis using 67064-1-Ig (same clone as 67064-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 67064-1-Ig (PLCD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67064-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67064-1-Ig (same clone as 67064-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67064-1-Ig (PLCD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67064-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 67064-1-Ig (same clone as 67064-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 67064-1-Ig (PLCD1 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67064-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 67064-1-Ig (same clone as 67064-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 67064-1-Ig (PLCD1 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67064-1-PBS in a different storage buffer formulation.

• 

  FC experiment of K-562 using 67064-1-Ig (same clone as 67064-1-PBS)

  1x10^6 K-562 cells were intracellularly stained with 0.2 ug PLCD1 Monoclonal antibody (67064-1-Ig, Clone:1D10B11) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.2 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67064-1-PBS in a different storage buffer formulation.

PLCD1 Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 67064-1-PBS

Clone No.1D10B11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

1D10B11, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1, EC:3.1.4.11, Phosphoinositide phospholipase C-delta-1, Phospholipase C delta 1

---

Product Information

67064-1-PBS targets PLCD1 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5567

  Product name: Recombinant human PLCD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 412-756 aa of BC050382

  Sequence: MLLNRPLDGVTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQHKPKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFVRHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEIHGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALIRFLVEDYDASSKNDFIGQSTIPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD

• Full Name: phospholipase C, delta 1
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC050382
• Gene Symbol: PLCD1
• Gene ID (NCBI): 5333
• RRID: AB_2882374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51178
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.