Use Able AI chat for product recommendations

PLCG1 Recombinant monoclonal antibody, PBS Only

PLCG1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84941-4-PBS
Clone No.242529B11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Phospholipase C II, Phospholipase C gamma 1, Phosphoinositide phospholipase C-gamma-1, EC:3.1.4.11, 242529B11

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84941-4-PBS targets PLCG1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27218

Product name: Recombinant human PLCG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 467-563 aa of

Sequence: AEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH

Predict reactive species
Full Name phospholipase C, gamma 1
Calculated Molecular Weight 149 kDa
Observed Molecular Weight 149 kDa
Gene Symbol PLCG1
Gene ID (NCBI) 5335
RRIDAB_3743867
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP19174
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Phosphoinositide phospholipase C-gamma-1 (PLCG1) which belongs to the phosphoinositide-specific phospholipase C (PLC) family, is activated by many extracellular stimuli including hormones, neurotransmitters, and growth factors and modulates several cellular and physiological functions necessary for tumorigeneses such as cell survival, migration, invasion, and angiogenesis by generating inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG) via hydrolysis of phosphatidylinositol 4,5-biphosphate (PIP2) (PMID: 9242915). Phosphorylation is one of the key mechanisms that regulate the activity of PLC. PLCγ is activated by both receptor and non-receptor tyrosine kinases (PMID: 2472218). PLCγ forms a complex with EGF and PDGF receptors, which leads to the phosphorylation of PLCγ at Tyr771, 783, and 1248 (PMID: 1708307). It has also been shown that PKA-mediated phosphorylation at Ser1248 is inhibitory to PLCγ1 tyrosine phosphorylation and phospholipase activity in CD3-treated Jurkat cells (PMID: 1370476), suggesting that Ser1248 may be an allosteric regulator of PLCγ1 activity.

Loading...
||
New chat

Able

正在加载,请稍候...