PLCG1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84941-4-RR (same clone as 84941-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84941-4-RR (PLCG1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84941-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84941-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84941-4-RR against Human PLCG1 were performed. The affinity constant is 3.90 nM.

PLCG1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84941-4-PBS

Clone No.242529B11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Phospholipase C II, Phospholipase C gamma 1, Phosphoinositide phospholipase C-gamma-1, EC:3.1.4.11, 242529B11

---

Product Information

84941-4-PBS targets PLCG1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27218

  Product name: Recombinant human PLCG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 467-563 aa of

  Sequence: AEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH

• Full Name: phospholipase C, gamma 1
• Calculated Molecular Weight: 149 kDa
• Observed Molecular Weight: 149 kDa
• Gene Symbol: PLCG1
• Gene ID (NCBI): 5335
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P19174
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phosphoinositide phospholipase C-gamma-1 (PLCG1) which belongs to the phosphoinositide-specific phospholipase C (PLC) family, is activated by many extracellular stimuli including hormones, neurotransmitters, and growth factors and modulates several cellular and physiological functions necessary for tumorigeneses such as cell survival, migration, invasion, and angiogenesis by generating inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG) via hydrolysis of phosphatidylinositol 4,5-biphosphate (PIP2) (PMID: 9242915). Phosphorylation is one of the key mechanisms that regulate the activity of PLC. PLCγ is activated by both receptor and non-receptor tyrosine kinases (PMID: 2472218). PLCγ forms a complex with EGF and PDGF receptors, which leads to the phosphorylation of PLCγ at Tyr771, 783, and 1248 (PMID: 1708307). It has also been shown that PKA-mediated phosphorylation at Ser1248 is inhibitory to PLCγ1 tyrosine phosphorylation and phospholipase activity in CD3-treated Jurkat cells (PMID: 1370476), suggesting that Ser1248 may be an allosteric regulator of PLCγ1 activity.