PLCG2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PLCG2 Polyclonal antibody (27173-1-AP)

PLCG2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27173-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

Phospholipase C gamma 2, Phospholipase C IV, PLC gamma 2, PLC IV, PLC γ2, PLCG2, PLCγ2

• 

  WB analysis using 27173-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27173-1-AP (PLCG2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 27173-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27173-1-AP (PLCG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 27173-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27173-1-AP (PLCG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PLCG2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Daudi cells, Raji cells, Ramos cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27173-1-AP targets PLCG2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25847

  Product name: Recombinant human PLCG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 826-928 aa of BC007565

  Sequence: DISTADFEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGYPPVEFATDRVEELFEWFQSIREITWKIDTKENNMKYWEKNQSIAI

• Full Name: phospholipase C, gamma 2 (phosphatidylinositol-specific)
• Calculated Molecular Weight: 148 kDa
• Observed Molecular Weight: 148 kDa
• GenBank Accession Number: BC007565
• Gene Symbol: PLCG2
• Gene ID (NCBI): 5336
• RRID: AB_2880785
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16885
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PLCG2 Polyclonal antibody (Cat# 27173-1-AP) has 1 citation. It was used in a study published in Scientific Reports (2025), which employed single-cell transcriptomics to investigate cellular evolution underlying pleomorphic adenoma recurrence and malignant transformation. The antibody was applied in immunofluorescence (IF) on human samples. The research field encompasses salivary gland tumor biology, cancer progression, and single-cell genomics.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Sci Rep; Single-cell transcriptomics reveals cellular evolution underlying pleomorphic adenoma recurrence and malignant transformation.; Authors - Yike Li