PLCL2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67471-1-Ig (same clone as 67471-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67471-1-Ig (PLCL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67471-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67471-1-Ig (same clone as 67471-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 67471-1-Ig (PLCL2 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67471-1-PBS in a different storage buffer formulation.

PLCL2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67471-1-PBS

Clone No.1C8A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

1C8A4, Inactive phospholipase C-like protein 2, KIAA1092, Phospholipase C L2, Phospholipase C-epsilon-2

---

Product Information

67471-1-PBS targets PLCL2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11461

  Product name: Recombinant human PLCL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 653-1001 aa of BC036392

  Sequence: VDPYVYVEIHGIPADCAEQRTKTVHQNGDAHIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPRKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE

• Full Name: phospholipase C-like 2
• Calculated Molecular Weight: 126 kDa
• Observed Molecular Weight: 126 kDa
• GenBank Accession Number: BC036392
• Gene Symbol: PLCL2
• Gene ID (NCBI): 23228
• RRID: AB_2882700
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UPR0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLCL2, a novel phospholipase C-like protein, is expressed in lymphocytes and platelets. The expression of PLCL2 is associated with the proliferation of mature B cells in the immune system. PLCL2 is a new susceptibility loci for myocardial infarction. It has been shown that PLCL2 plays a key role in the pathogenesis of atherosclerosis and systemic sclerosisit. There are three isoforms of PLCL2 protein and 67471-1-Ig antibody detects the 126 kDa band in SDS-PAGE. (PMID: 24916648, 25880423)