PLEKHA3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PLEKHA3 Polyclonal antibody (11292-1-AP)

PLEKHA3 Polyclonal Antibody for WB, ELISA

Cat No. 11292-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

FAPP 1, FAPP1, FAPP-1, PH domain-containing family A member 3, Phosphatidylinositol-four-phosphate adapter protein 1

• 

  WB analysis using 11292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11292-1-AP (PLEKHA3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PLEKHA3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: COLO 320 cells, Jurkat cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11292-1-AP targets PLEKHA3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1851

  Product name: Recombinant human PLEKHA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC044567

  Sequence: MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS

• Full Name: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC044567
• Gene Symbol: PLEKHA3
• Gene ID (NCBI): 65977
• RRID: AB_10637846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HB20
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PLEKHA3 Polyclonal antibody (Cat# 11292-1-AP) has 1 total citation. The cited publication appeared in bioRxiv (2024) and investigated spatiotemporal proteomic profiling of cellular responses to NLRP3 agonists, placing it in the research fields of inflammasome biology and proteomics. The antibody was applied in Western Blot (WB) using human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; Spatiotemporal proteomic profiling of cellular responses to NLRP3 agonists.; Authors - L. Robert Hollingsworth