PLK1 Polyclonal antibody

PLK1 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 12098-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

PLK, PLK 1, PLK1, Polo like kinase 1, STPK13

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, U2OS cells
Positive IP detected inmouse testis tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12098-1-AP targets PLK1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2742

Product name: Recombinant human PLK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-307 aa of BC014846

Sequence: MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTS

Predict reactive species
Full Name polo-like kinase 1 (Drosophila)
Calculated Molecular Weight 603 aa, 68 kDa
GenBank Accession NumberBC014846
Gene Symbol PLK1
Gene ID (NCBI) 5347
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP53350
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLK1(Polo-like kinase 1), also named as PLK and STPK13, belongs to the protein kinase superfamily, Ser/Thr protein kinase family and CDC5/Polo subfamily. PLK1 is a Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivation of APC/C inhibitors, and the regulation of mitotic exit and cytokinesis.The localization of Polo changes during the cell cycle. In interphase, Polo shows a mostly diffuse cytoplasmic localization. Polo becomes concentrated on centrosomes from early prophase and appears on centromeres or kinetochores from late prophase, before nuclear envelope breakdown (NEB). After anaphase onset, Polo relocalizes to the central spindle and remains enriched at the midbody ring in late stages of cytokinesis (PMID: 29167465).

Publications

SpeciesApplicationTitle
humanWB,IHC

Mol Biotechnol

Overexpression of PLK1 Molecule Following Incomplete Thermal Ablation Promotes the Proliferation and Invasion of Residual Hepatocellular Carcinoma

Authors - Tong Kang
Loading...
||
New chat Able
正在加载,请稍候...