PLK3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLK3 Polyclonal antibody, PBS Only (30486-1-PBS)

• 

  WB analysis using 30486-1-AP (same clone as 30486-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30486-1-AP (PLK3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30486-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 30486-1-AP (same clone as 30486-1-PBS)

  IP result of anti-PLK3 (IP:30486-1-AP, 4ug; Detection:30486-1-AP 1:500) with HeLa cells lysate 1750 ug. This data was developed using the same antibody clone with 30486-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 30486-1-AP (same clone as 30486-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 30486-1-AP (PLK3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30486-1-PBS in a different storage buffer formulation.

PLK3 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 30486-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

PLK 3, FNK, FGF-inducible kinase, EC:2.7.11.21, Cytokine-inducible serine/threonine-protein kinase

---

Product Information

30486-1-PBS targets PLK3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33186

  Product name: Recombinant human PLK3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 550-646 aa of BC013899

  Sequence: PSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA

• Full Name: polo-like kinase 3 (Drosophila)
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC013899
• Gene Symbol: PLK3
• Gene ID (NCBI): 1263
• RRID: AB_3669726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4B4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLK3(Polo-like kinase 3) is also named as CNK, FNK, PRK and belongs to the protein kinase superfamily. It is involved in the regulation of DNA damage checkpoint as well as in M-phase function. Plk3 physically interacts with p53 and phosphorylates this tumor suppressor protein on serine-20, suggesting that the role of Plk3 in cell cycle progression is mediated, at least in part, through direct regulation of p53(PMID:12548019).