Plasmolipin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Plasmolipin Polyclonal antibody (14868-1-AP)

Plasmolipin Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14868-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

PLLP, Plasma membrane proteolipid, PMLP, TM4SF11

• 

  WB analysis using 14868-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14868-1-AP (Plasmolipin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 14868-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 14868-1-AP (Plasmolipin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 14868-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 14868-1-AP (Plasmolipin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14868-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14868-1-AP (Plasmolipin antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14868-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14868-1-AP (Plasmolipin antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Plasmolipin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: rat brain tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14868-1-AP targets Plasmolipin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6425

  Product name: Recombinant human PLLP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-182 aa of BC002760

  Sequence: MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVMFVAVFLWLVTIVLFNLYLFQLHMKLYMVPWPLVLMIFNISATVLYITAFIACSAAVDLTSLRGTRPYNQRAAASFFACLVMIAYGVSAFFSYQAWRGVGSNAATSQMAGGYA

• Full Name: plasma membrane proteolipid (plasmolipin)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC002760
• Gene Symbol: PLLP
• Gene ID (NCBI): 51090
• RRID: AB_2284162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y342
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Plasmolipin Polyclonal antibody (Cat# 14868-1-AP) has 1 citation. It appears in the Journal of Biological Chemistry (IF 4.1), published in 2026. The cited study investigates how PLLP inhibits WT p53 gastric cancer progression by reducing p53 protein ubiquitination through binding to TRIM59. The research field encompasses gastric cancer biology, p53-mediated tumor suppression, and protein ubiquitination pathways. The antibody was used in WB and IHC applications on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	J Biol Chem; PLLP inhibits the progression of WT p53 gastric cancer by reducing p53 protein ubiquitination by binding to TRIM59.; Authors - Zhenhao Quan ; KD Validated