Able AI
What's the best dilution for PLOD1 in ?
Product Information
85662-1-PBS targets PLOD1 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag31626 Product name: Recombinant human PLOD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 450-564 aa of BC016657 Sequence: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEV Predict reactive species |
| Full Name | procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 |
| Calculated Molecular Weight | 727 aa, 84 kDa |
| GenBank Accession Number | BC016657 |
| Gene Symbol | PLOD1 |
| Gene ID (NCBI) | 5351 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q02809 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
