PLOD1 Recombinant monoclonal antibody, PBS Only

Name: PLOD1 Recombinant monoclonal antibody, PBS Only,
Brand: Proteintech

PLOD1 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85662-2-PBS

Clone No. 242403B6

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

EC:1.14.11.4, LH1, LLH, PLOD, Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1

Formulation: PBS Only

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllAffinity

Affinity and Kinetic Characterization of 85662-2-PBS
Biolayer interferometry (BLl) kinetic assay of 85662-2-PBS against Human PLOD1 was performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PLOD1 in ?

85662-2-PBS targets PLOD1 in Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag31626 Product name: Recombinant human PLOD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 450-564 aa of BC016657 Sequence: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEV Predict reactive species
Full Name	procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
Calculated Molecular Weight	727 aa, 84 kDa
GenBank Accession Number	BC016657
Gene Symbol	PLOD1
Gene ID (NCBI)	5351
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q02809
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.