PLOD1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PLOD1 Recombinant monoclonal antibody (85662-6-RR)

PLOD1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85662-6-RR

Clone No.242403C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:1.14.11.4, LH1, LLH, PLOD, Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1

• 

  WB analysis using 85662-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85662-6-RR (PLOD1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 85662-6-RR

  Biolayer interferometry (BLl) kinetic assays of 85662-6-RR against Human PLOD1 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A375 cells, HeLa cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85662-6-RR targets PLOD1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31626

  Product name: Recombinant human PLOD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 450-564 aa of BC016657

  Sequence: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEV

• Full Name: procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
• Calculated Molecular Weight: 727 aa, 84 kDa
• Observed Molecular Weight: 84-88 kDa
• GenBank Accession Number: BC016657
• Gene Symbol: PLOD1
• Gene ID (NCBI): 5351
• RRID: AB_3744273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02809
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLOD1, as known as procollagen‐lysine, 2‐oxoglutarate 5‐dioxygenase 1, is a member of the PLOD family(Uniprot, GeneID:5351). PLOD1 participates in catalyzing hydroxylysine residue, which is critical for the formation of covalent cross-link (PMID:30003082). PLOD1 plays an important role in the development and progression of tumors. Aberrantly expressed PLOD1 promotes cancer aggressiveness in glioma and bladder cancer, providing a potential prognostic biomarker and therapeutic target (PMID:31199049, PMID:34040895). PLOD1 has 2 isoforms produced by alternative splicing.