Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, HeLa cells, HepG2 cells, NIH/3T3 cells |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12917-1-AP targets PLS3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3574 Product name: Recombinant human PLS3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 281-630 aa of BC039049 Sequence: LENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV Predict reactive species |
| Full Name | plastin 3 (T isoform) |
| Calculated Molecular Weight | 630 aa, 71 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC039049 |
| Gene Symbol | PLS3 |
| Gene ID (NCBI) | 5358 |
| RRID | AB_2877892 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13797 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PLS3, also named T-plastin and Plastin-3, is an actin-bundling protein found in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia. It plays an important role in leukocyte function. L-plastin plays an important role in leukocyte function, and T-plastin is possibly involved in DNA repair. Both T- and L-plastin are implicated in several diseases, and L-plastin is considered to be a valuable marker for cancer (PMID: 15960882).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PLS3 antibody 12917-1-AP | Download protocol |
| IHC protocol for PLS3 antibody 12917-1-AP | Download protocol |
| IP protocol for PLS3 antibody 12917-1-AP | Download protocol |
| WB protocol for PLS3 antibody 12917-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PLS3 Polyclonal antibody (catalog 12917-1-AP) has 3 citations. They appear in Nature Communications, JCI Insight, and Cancers (Basel). Research fields span cytoskeleton protein homeostasis and cell migration during brain development, vascular smooth muscle cytoskeleton regulation and arterial stiffness, and head and neck squamous cell carcinoma prognosis with immune infiltrate correlation. Applications cited include WB, IHC, and CoIP across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Nat Commun Cul3 regulates cytoskeleton protein homeostasis and cell migration during a critical window of brain development. | ||
JCI Insight Vascular smooth muscle RbFox2 regulates the cytoskeleton and arterial stiffness by a RhoBTB1-Cullin-3 mechanism. | ||
Cancers (Basel) PLS3 Is a Prognostic Biomarker and Correlates with Immune Infiltrates in Head and Neck Squamous Cell Carcinoma.
|
Reviews
What customers say
The single review (5/5) highlights excellent performance in Western Blot, Immunoprecipitation, and Cell culture. The antibody showed the expected molecular weight at the correct position and performed well in smooth muscle cell knockout samples. The reviewer also noted reliable results at room temperature and overall stability, using a 1:5000 dilution on aorta and placenta tissues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Gaurav (Verified Customer) (02-06-2024) | Excellent antibody with expected molecular weight at right position. Works very well in knock out samples of Smooth Muscle Cells. Works even better at room temperature also. Very stable antibody.
 |
