PLXNA4 Polyclonal antibody

• 

  WB analysis using 17201-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17201-1-AP (PLXNA4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 17201-1-AP

  IP result of anti-PLXNA4 (IP:17201-1-AP, 4ug; Detection:17201-1-AP 1:800) with mouse brain tissue lysate 1720 ug.

PLXNA4 Polyclonal Antibody for WB, IP, ELISA

Cat No. 17201-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

FAYV2820, KIAA1550, PLEXA4, plexin A4, Plexin-A4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17201-1-AP targets PLXNA4 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10978

  Product name: Recombinant human PLXNA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-358 aa of BC028744

  Sequence: MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERTGHIYLGAVNRIYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLIDYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLDDKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDFDIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSLDESALCIF

• Full Name: plexin A4
• Calculated Molecular Weight: 522aa,58 kDa; 1894aa,212 kDa
• Observed Molecular Weight: 212 kDa
• GenBank Accession Number: BC028744
• Gene Symbol: PLXNA4
• Gene ID (NCBI): 91584
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCM2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLXNA4 is a plexin family receptor that transduces semaphorin signals to regulate axon guidance, vascular development, and immune cell migration. It functions as a plasma membrane receptor with intracellular GTPase-regulatory activity, linking extracellular cues to cytoskeletal remodeling. Dysregulation of PLXNA4 has been associated with neurological disease (including Alzheimer's), cancer progression, and vascular/immune dysfunction, making it a multifunctional receptor of significant biomedical interest. (PMID: 27127761)