PLXNB1 Polyclonal antibody

• 

  WB analysis using 29440-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29440-1-AP (PLXNB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 29440-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29440-1-AP (PLXNB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 29440-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29440-1-AP (PLXNB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PLXNB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29440-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA0407, plexin B1, PLXN5, PLXNB1, Semaphorin receptor SEP, SEP

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29440-1-AP targets PLXNB1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31224

  Product name: Recombinant human PLXNB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-352 aa of BC146793

  Sequence: FLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTE

• Full Name: plexin B1
• Calculated Molecular Weight: 2135 aa, 232 kDa
• Observed Molecular Weight: 200-250 kDa
• GenBank Accession Number: BC146793
• Gene Symbol: PLXNB1
• Gene ID (NCBI): 5364
• RRID: AB_2918306
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43157
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Semaphorins, originally identified as axon guidance molecules, have also been implicated in angiogenesis, immunoregulation, and cancer (PMID: 16584533). Plexins are main receptors for semaphorins and are thought to control many of the functional effects of semaphorins. PLXNB1 is one of the three plexin-B family members. It is a high-affinity receptor for semaphorin 4D (SEMA4D). Interaction of SEMA4D and PLXNB1 has important physiologic effects in the immune and nervous systems, and is also involved in tumor progression, especially in tumor angiogenesis (PMID: 20858260).