PMCA2 Polyclonal antibody

• 

  WB analysis using 28423-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28423-1-AP (PMCA2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 28423-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28423-1-AP (PMCA2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 28423-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28423-1-AP (PMCA2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat brain using 28423-1-AP

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using PMCA2 antibody (28423-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

PMCA2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 28423-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

ATP2B2, PMCA2, PMCA2a, PMCA2i

---

Tested Applications

• Positive WB detected in: unboiled mouse brain tissue
• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

28423-1-AP targets PMCA2 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28994

  Product name: Recombinant human PMCA2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 578-782 aa of NM_001001331

  Sequence: LDLKQDYEPVRSQMPEEKLYKVYTFNSVRKSMSTVIKLPDESFRMYSKGASEIVLKKCCKILNGAGEPRVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNEKGEIEQERIDKIW

• Full Name: ATPase, Ca++ transporting, plasma membrane 2
• Calculated Molecular Weight: 137 kDa
• Observed Molecular Weight: 137 kDa
• GenBank Accession Number: NM_001001331
• Gene Symbol: PMCA2
• Gene ID (NCBI): 491
• RRID: AB_3086051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01814
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP2B2, also named as PMCA2, belongs to the cation transport ATPase (P-type) family and type IIB subfamily. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Tissue Cell; Immunolabel imaging of plasma membrane Ca++ pumps (PMCA-pan or PMCA2) implicates the apical cilium on receptor cells as the transduction site for electrosense in two Acipenseriformes fishes; Authors - David F Russell

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hanna (Verified Customer) (04-03-2024)

It works fine in staining of primary neuron cell culture.

• Applications: Immunofluorescence, Cell culture
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Neural culture