PMP2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85594-5-RR (same clone as 85594-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85594-5-RR (PMP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85594-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85594-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85594-5-RR against Human PMP2 were performed. The affinity constant is 0.279 nM.

PMP2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85594-5-PBS

Clone No.243016D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, Indirect ELISA

Synonyms

FABP8, M-FABP, Myelin P2 protein

---

Product Information

85594-5-PBS targets PMP2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3411

  Product name: Recombinant human PMP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-132 aa of BC034997

  Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

• Full Name: peripheral myelin protein 2
• Calculated Molecular Weight: 132 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC034997
• Gene Symbol: PMP2
• Gene ID (NCBI): 5375
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02689
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PMP2 (peripheral myelin protein-2, also known as P2) is one of the major proteins of peripheral myelin and appears to be related to the transport of fatty acids or the metabolism of myelin lipids.P2 constitutes up to 15% of total protein of peripheral nervous system (PNS) myelin. It is also present in small amounts in central nervous system (CNS) myelin, being abundant in spinal cord and brain stem myelin. As a structural protein, P2 is thought to stabilize the myelin membranes.